DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdk and creC

DIOPT Version :10

Sequence 1:NP_001097240.1 Gene:Pdk / 35970 FlyBaseID:FBgn0017558 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_418816.1 Gene:creC / 948609 ECOCYCID:EG10730 Length:474 Species:Escherichia coli


Alignment Length:83 Identity:24/83 - (28%)
Similarity:39/83 - (46%) Gaps:12/83 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 KEDICVKISDQGGGIPRSQTDQLFKYMYSTAPQPS--KSDLHTVPLAGYGYGLPISRLYARYFHG 347
            :|.:.:|:.|.|.|||.....::|:..|| .|:.:  ||.         |.||......||.|:|
E. coli   397 QEHVTLKVLDTGSGIPDYALSRIFERFYS-LPRANGQKSS---------GLGLAFVSEVARLFNG 451

  Fly   348 DIVLLSCEGFGTDAIIYL 365
            ::.|.:.:..|..|.:.|
E. coli   452 EVTLRNVQEGGVLASLRL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdkNP_001097240.1 BCDHK_Adom3 32..193 CDD:463093
HATPase_PDK-like 197..366 CDD:340406 24/83 (29%)
creCNP_418816.1 PRK11100 1..473 CDD:236846 24/83 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.