DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdk and SKN7

DIOPT Version :9

Sequence 1:NP_001097240.1 Gene:Pdk / 35970 FlyBaseID:FBgn0017558 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_012076.3 Gene:SKN7 / 856613 SGDID:S000001249 Length:622 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:24/119 - (20%)
Similarity:48/119 - (40%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NACEKKSYIFLRKELPVRLANIMKEIALLPDNLLHTR-SVSEVSSWYVKSFEDVLVYEKAEPTHD 107
            |...|.::..||:    |:..:.||:.:.......|: .:.:::|.|....|.::.:   :..::
Yeast   233 NTVSKDAFGNLRR----RVDKLQKELDMSKMESYATKVELQKLNSKYNTVIESLITF---KTINE 290

  Fly   108 NLQKFVADLDLIRNRHNDVVQTMAQGVIEM-------KENEGGQVDAPTESSIQ 154
            ||          .|..|.:..|:|...||:       ..|..|..:..|.::||
Yeast   291 NL----------LNNFNTLCSTLANNGIEVPIFGDNGNRNPTGNTNPATTTAIQ 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdkNP_001097240.1 BCDHK_Adom3 32..193 CDD:402181 24/119 (20%)
HATPase_PDK-like 197..366 CDD:340406
SKN7NP_012076.3 HSF1 75..350 CDD:227497 24/119 (20%)
REC_hyHK_CKI1_RcsC-like 379..488 CDD:381099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0642
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.