| Sequence 1: | NP_001097240.1 | Gene: | Pdk / 35970 | FlyBaseID: | FBgn0017558 | Length: | 422 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_187078.1 | Gene: | RR22 / 819583 | AraportID: | AT3G04280 | Length: | 142 | Species: | Arabidopsis thaliana |
| Alignment Length: | 39 | Identity: | 13/39 - (33%) |
|---|---|---|---|
| Similarity: | 17/39 - (43%) | Gaps: | 9/39 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 36 KQFMDFGQNACEKKSYIFLRKELPVRLANIMKEIALLPD 74 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pdk | NP_001097240.1 | BCDHK_Adom3 | 32..193 | CDD:463093 | 13/39 (33%) |
| HATPase_PDK-like | 197..366 | CDD:340406 | |||
| RR22 | NP_187078.1 | REC_hyHK_CKI1_RcsC-like | 24..136 | CDD:381099 | 10/32 (31%) |
| Blue background indicates that the domain is not in the aligned region. | |||||