DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prel and UPS3

DIOPT Version :9

Sequence 1:NP_001260824.1 Gene:prel / 35969 FlyBaseID:FBgn0033413 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_010471.1 Gene:UPS3 / 851766 SGDID:S000002593 Length:179 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:52/164 - (31%)
Similarity:78/164 - (47%) Gaps:9/164 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRD--GKLFSRRLLSKTNPVPKWGARFYNNVP 76
            |||.|..|..|.|.:|||..||||:..|.::||:::  ..|.:.||::.....|.|.:....|..
Yeast    10 FDYPWEKVTTANWMKYPNKISTHVIAVDVLRRELKEHGDVLLTERLITIRQNTPHWMSILVGNTN 74

  Fly    77 VKIV-EDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVY---SEQKDGSTLAVRRAYISSQV--FG 135
            :..| |.|.:|...::.|..:.|:....|:|..|.|.|   .:.....||..:.|...|.|  ..
Yeast    75 LAYVREVSTVDRRDRSLTMRSCNMTFPHILKCYETVRYVPHPKNPSNVTLFKQDAKFLSGVPTKT 139

  Fly   136 FSRAIRAFGIERFKANGNKASNGFNYVLRRMFPD 169
            ||..:..:|::||..|..|...||:.:| .||.|
Yeast   140 FSEKVENWGVKRFSDNAVKGKVGFDSIL-AMFND 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prelNP_001260824.1 PRELI 21..164 CDD:282550 44/150 (29%)
UPS3NP_010471.1 PRELI 15..171 CDD:398400 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.