DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prel and AT5G13070

DIOPT Version :9

Sequence 1:NP_001260824.1 Gene:prel / 35969 FlyBaseID:FBgn0033413 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_196811.1 Gene:AT5G13070 / 831146 AraportID:AT5G13070 Length:183 Species:Arabidopsis thaliana


Alignment Length:175 Identity:41/175 - (23%)
Similarity:74/175 - (42%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RTETVFDYSWMNVVVAYWNRYPNPSS----THVLTEDTIQR--EVRDGKLFSRRLLSKTNPVPKW 67
            |.|.|:.:.|..|..|.|.::.:|.:    :|:|..||:.|  :...|||.:.|.|:...|.|.:
plant     6 RQEHVYKHPWERVSAASWRKFADPENKRILSHILEVDTLNRKLDTETGKLHTTRALTIHAPGPWF 70

  Fly    68 GARFYNNVPVKIVEDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVYSEQKDGS---TLAVRRAYI 129
            ..|.........||.:|:|...::....|:|:.:.|.::|:|.:.|....|..   |:..:...|
plant    71 LHRIIGQDICHCVESTVVDGKSRSMQLTTKNISLKKFIEVEERIRYDPHPDNPSAWTVCSQETSI 135

  Fly   130 S----SQVFGFSRAIRAFGIERFKANGNKASNGFNYVLRRMFPDS 170
            .    |.:...:..:.....|:|..|..|.......:.:.|..:|
plant   136 RIKPLSALASMAEKVEQKCAEKFMQNSAKGREVMERICKYMEAES 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prelNP_001260824.1 PRELI 21..164 CDD:282550 35/155 (23%)
AT5G13070NP_196811.1 PRELI 16..179 CDD:398400 36/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11158
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2787
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.