DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment prel and prelid1a

DIOPT Version :9

Sequence 1:NP_001260824.1 Gene:prel / 35969 FlyBaseID:FBgn0033413 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_956660.1 Gene:prelid1a / 393337 ZFINID:ZDB-GENE-040426-1341 Length:210 Species:Danio rerio


Alignment Length:208 Identity:84/208 - (40%)
Similarity:112/208 - (53%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SWMNVVVAYWNRYPNPSSTHVLTEDTIQREVR-DGKLFSRRLLSKTNPVPKWGARFYNNVPVK-- 78
            ||..|..|:|.|||||.|.||||||.|.|||. |..|.|||||:||:..|:|..:|   :|..  
Zfish    14 SWDQVSSAFWQRYPNPYSNHVLTEDIIFREVTPDNCLKSRRLLTKTSRAPRWAEKF---LPAHMA 75

  Fly    79 ----IVEDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVYSEQKDGS--TLAVRRAYISSQVFGFS 137
                |:||||:||..||.||.|.|:...::|.::|..||....:.|  |...|:|:|||:::|.|
Zfish    76 QKAYIIEDSVVDPQGKTLTTLTWNISHARVMSIEERCVYKVNPENSSWTEIERQAWISSKLYGLS 140

  Fly   138 RAIRAFGIERFKANGNKASNGFNYVLRRMFPDSLVGGGHHQHAVTTTSPAGELPATTITVSTTNG 202
            |||:.||:.|||:|..|...||.|:|.:|                    .||:|..|:..:.|..
Zfish   141 RAIQEFGLARFKSNVTKTMKGFEYILAKM--------------------QGEMPTRTLAETATVK 185

  Fly   203 SLNNQGALKSAAK 215
            :.....|.|..||
Zfish   186 ARETALAAKEKAK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
prelNP_001260824.1 PRELI 21..164 CDD:282550 71/151 (47%)
prelid1aNP_956660.1 PRELI 16..172 CDD:282550 73/178 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575998
Domainoid 1 1.000 129 1.000 Domainoid score I5223
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40859
Inparanoid 1 1.050 137 1.000 Inparanoid score I4525
OMA 1 1.010 - - QHG52842
OrthoDB 1 1.010 - - D1369397at2759
OrthoFinder 1 1.000 - - FOG0004716
OrthoInspector 1 1.000 - - otm24949
orthoMCL 1 0.900 - - OOG6_104463
Panther 1 1.100 - - LDO PTHR11158
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1608
SonicParanoid 1 1.000 - - X2787
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.