DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13955 and Mad1l1

DIOPT Version :9

Sequence 1:NP_610486.1 Gene:CG13955 / 35968 FlyBaseID:FBgn0033412 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_036020731.1 Gene:Mad1l1 / 17120 MGIID:1341857 Length:725 Species:Mus musculus


Alignment Length:385 Identity:86/385 - (22%)
Similarity:160/385 - (41%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLTRTDRRNLKSQISFQVAQKMHEWHADLDNRRWNLCLLLQKEALEADEQIAEMLQAQADE--AD 68
            :|.:.:|..::.::|.:.|:...|..|..:.|.:      ::|.....|.:|.:.|.|..|  |:
Mouse    63 YLIQVEREKMQMELSHKRARVELERAASTNARNY------EREVDRNQELLARIRQLQECEATAE 121

  Fly    69 RKRHEWIEMERLKREEAEMELVKVKKQQREIENSEAH-RHMLT------KEILLES--KQAQLHQ 124
            .|..|.:|..||    .:..|..|.:|.||.|:|.|. |.|::      .|:.|.:  ::.|:.:
Mouse   122 EKMREQLERHRL----CKQNLDAVSQQLREQEDSLASAREMISSLKGRVSELQLSAMDQKVQVKR 182

  Fly   125 IE-EKKALKRRQACVEILWQRVWQRLDESKAQQE---QHELKLRNLIENRCQAHNLDTDREQKAQ 185
            :| ||:.||.:....:..||...|::.|.:|.|:   :||.|:::|.:..|.       :||.|.
Mouse   183 LESEKQELKEQLELQQRKWQEANQKIQELQASQDERAEHEQKIKDLEQKLCL-------QEQDAA 240

  Fly   186 FAKEVLAD-------QRECSQALELAAEMDVLKKQEDL---------KKL--KDKRRQQLIDLQD 232
            ..|.:.::       :||..:..|....:..:|:...|         :||  ::|.::.|:||  
Mouse   241 VVKSMKSELMRMPRMERELKRLHEENTHLREMKETNGLLTEELEGLQRKLSRQEKMQEALVDL-- 303

  Fly   233 QIKWNLTISARQAQANIREDVGYNI---------------------------------------- 257
            :::....::..|:..|:.:.:|.|:                                        
Mouse   304 ELEKEKLLAKLQSWENLDQTMGLNLRTPEDLSRFVVELQQRELTLKEKNNSITSSARGLEKVQQQ 368

  Fly   258 LED--RQIYEELMEKRCARIHNRDWHQQYMTHTA-AERAARREEDLARDRKYLGTGCVLG 314
            |:|  ||...:|:|:|..|          .||.| |.|..:|...|.::|.  |...:||
Mouse   369 LQDEVRQANAQLLEERKKR----------ETHEALARRLQKRNALLTKERD--GMRAILG 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13955NP_610486.1 None
Mad1l1XP_036020731.1 MAD 54..665 CDD:368498 86/385 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.