DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and PLPPR4

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_055654.3 Gene:PLPPR4 / 9890 HGNCID:23496 Length:715 Species:Homo sapiens


Alignment Length:321 Identity:97/321 - (30%)
Similarity:146/321 - (45%) Gaps:64/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VLILLCAGF---PIL------LFFL----LGEPYKRGFFCDDESLKHPFHDST---VRNWMLYFI 142
            |.:|.|..|   |||      |:||    :.:|...||.|.|.||..|:.:.|   :...||..:
Human    16 VTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSL 80

  Fly   143 GAVIPVGVIFIVEVIISQNKAKQDNG--------------NATSRRYVFMNYELPDWMIECYKKI 193
            ....|...|.:.|.|:....:|:.||              |:..||.|              :.:
Human    81 AFAGPAITIMVGEGILYCCLSKRRNGVGLEPNINAGGCNFNSFLRRAV--------------RFV 131

  Fly   194 GIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMAD-GSTCDDAINAGKYIQEFTCKGVGSSA 257
            |::.||...:.|.|||.:.|.|...|:|:.||:|.... ..:|.:    ..||.|..|.  ||..
Human   132 GVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKE----NSYIVEDICS--GSDL 190

  Fly   258 RMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYK 322
            .::...|.||||.|::...||.||:::|..:.:| ..||||:.||.|.||:......|:|::.||
Human   191 TVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLT-DSSKLLKPLLVFTFIICGIICGLTRITQYK 254

  Fly   323 HHWSDVLAGSLIGSISAL-----VVANYV-SD--LFQKPNTKPYLARTVQDMNASPAQAIT 375
            :|..||..|.|||...||     .|.|:: ||  :||..:.    .|::.|:|..|.:.::
Human   255 NHPVDVYCGFLIGGGIALYLGLYAVGNFLPSDESMFQHRDA----LRSLTDLNQDPNRLLS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 55/160 (34%)
PLPPR4NP_055654.3 PAP2_wunen 126..275 CDD:239479 57/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144645
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.