DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and ybjG

DIOPT Version :10

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_415362.1 Gene:ybjG / 945450 ECOCYCID:G6439 Length:198 Species:Escherichia coli


Alignment Length:77 Identity:27/77 - (35%)
Similarity:35/77 - (45%) Gaps:16/77 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 SFPSGHSSFTF-FAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWS-DV 328
            ||||.|.:..| ||:.:|..:    ..|.||     ||..|.:::||......|     ||. |:
E. coli   100 SFPSDHGTVIFTFALAFLCWH----RLWSGS-----LLMVLAVVIAWSRVYLGV-----HWPLDM 150

  Fly   329 LAGSLIGSISAL 340
            |.|.|.|.|..|
E. coli   151 LGGLLAGMIGCL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 27/77 (35%)
ybjGNP_415362.1 PRK11837 1..198 CDD:183335 27/77 (35%)

Return to query results.
Submit another query.