DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and PLPP2

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_808211.1 Gene:PLPP2 / 8612 HGNCID:9230 Length:309 Species:Homo sapiens


Alignment Length:282 Identity:109/282 - (38%)
Similarity:161/282 - (57%) Gaps:27/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNK 162
            |.|..|..:..|:..||||||:|.|:|:::|:...|:.:.::  .|..|...||     ::|..:
Human    37 LGASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLM--AGVTITATVI-----LVSAGE 94

  Fly   163 AKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQP 227
            |.....:....|..|.||     :...||.:|.:.|||.:||..||:|||.||||||:|:|||.|
Human    95 AYLVYTDRLYSRSDFNNY-----VAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDP 154

  Fly   228 QMADGSTCDDAINAGKYIQ-EFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMT 291
            ..:       .:|...|:| |..|:|   :...:.|.||||.||||||..:.||:||||:|||:.
Human   155 DWS-------RVNCSVYVQLEKVCRG---NPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLC 209

  Fly   292 WRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLFQ-KPNT 355
            |:.::|||..:||..:..|.|...:|||||||||||||.|.|.|::.|.:...|:||.|: :|  
Human   210 WKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARP-- 272

  Fly   356 KPYLARTVQDMNASPAQAITIT 377
             |......:::...|:.::|:|
Human   273 -PQHCLKEEELERKPSLSLTLT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 75/155 (48%)
PLPP2NP_808211.1 PAP2_wunen 115..261 CDD:239479 75/155 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144681
Domainoid 1 1.000 156 1.000 Domainoid score I4177
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 204 1.000 Inparanoid score I3741
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm8567
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.