DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and CAX4

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_011550.3 Gene:CAX4 / 852924 SGDID:S000003268 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:42/226 - (18%)
Similarity:77/226 - (34%) Gaps:77/226 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 DDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDW 185
            ||..:.:..||      .|.|:.|...:..|.::...:|                         |
Yeast    18 DDTYILYDSHD------FLSFLSAYFSLMPILVLAFYLS-------------------------W 51

  Fly   186 MI------ECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKY 244
            .|      .|     |.|||.:::::..::.|..|.:.||                   ::.|..
Yeast    52 FIITRELEAC-----IVAFGQLMNEIFNNVIKNIIKQPRP-------------------VSFGAS 92

  Fly   245 IQEFTCK-GVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLL-RHLLQFLFI 307
            .|..|.: |.|            .||.||.|..|...|.:|.:..  :|:....| :.:......
Yeast    93 FQNDTIRSGYG------------MPSAHSQFMGFCFTYNSLKIYT--SWKNLNFLEKCIFSGALA 143

  Fly   308 MVAWYTALSRVSDYKHHWSDVLAGSLIGSIS 338
            ::::....|||..:.|:...|:.|..:|:::
Yeast   144 LLSFCVCFSRVYLHYHNLDQVIVGFSVGALT 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 31/153 (20%)
CAX4NP_011550.3 PAP2_dolichyldiphosphatase 17..179 CDD:239477 42/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.