DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and DPP1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_010570.1 Gene:DPP1 / 851878 SGDID:S000002692 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:252 Identity:73/252 - (28%)
Similarity:119/252 - (47%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VLILLCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDS-TVRNWMLYFIGAVIPVGVIFIVEVI 157
            ::|::...:|:    ...:|::|.|:.:|.::.||:..: .|.|.||:....|:|...|.|:..|
Yeast    25 LIIMILLNYPV----YYQQPFERQFYINDLTISHPYATTERVNNNMLFVYSFVVPSLTILIIGSI 85

  Fly   158 ISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFI 222
            :           |..|..:|:.|.         ..:|: :.....:...|:..|..||||||.|:
Yeast    86 L-----------ADRRHLIFILYT---------SLLGL-SLAWFSTSFFTNFIKNWIGRLRPDFL 129

  Fly   223 AVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSS---ARMLKEMRLSFPSGHSSFTFFAMVYLAL 284
            ..|||  .:|...|..         ||.|.|.::   .|:|...|.: ||||||.:|..:.||..
Yeast   130 DRCQP--VEGLPLDTL---------FTAKDVCTTKNHERLLDGFRTT-PSGHSSESFAGLGYLYF 182

  Fly   285 YLQARMTWRG--SKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISA 339
            :|..::....  ..|.|.::.||.::.|...||||..||:||:.||:.||::|.|.|
Yeast   183 WLCGQLLTESPLMPLWRKMVAFLPLLGAALIALSRTQDYRHHFVDVILGSMLGYIMA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 52/157 (33%)
DPP1NP_010570.1 PAP2_containing_1_like 50..245 CDD:239484 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.