DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and LPP2

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_172961.1 Gene:LPP2 / 838072 AraportID:AT1G15080 Length:290 Species:Arabidopsis thaliana


Alignment Length:279 Identity:84/279 - (30%)
Similarity:128/279 - (45%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DVLILLCAGFPILLFFLLG--EPYKRGFFCDD--ESLKHPFHDSTVRNWMLYFIGAVIPVGVIFI 153
            |.||||..   |::..:|.  ||:.| |..:|  ..|::|..|:|:..|.:..|..|:|..||.:
plant    25 DWLILLLL---IVIEIVLNVIEPFHR-FVGEDMLTDLRYPLQDNTIPFWAVPLIAVVLPFAVICV 85

  Fly   154 VEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLR 218
                                 |.|:..::.|..   :..:|: .|..:::.:.||..|.::||.|
plant    86 ---------------------YYFIRNDVYDLH---HAILGL-LFSVLITGVITDAIKDAVGRPR 125

  Fly   219 PHFIAVCQPQMADGSTCDDAI----NAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAM 279
            |.|...|.|         |.|    |..|.:   .|.|   :..::||...||||||:|::|..:
plant   126 PDFFWRCFP---------DGIGIFHNVTKNV---LCTG---AKDVVKEGHKSFPSGHTSWSFAGL 175

  Fly   280 VYLALYLQARM---TWRG--SKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISA 339
            .:|:|||..::   ..||  :||   .:..|.::||....:|||.||.|||.||..|::||    
plant   176 GFLSLYLSGKIRVFDQRGHVAKL---CIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIG---- 233

  Fly   340 LVVANYVSDLFQKPNTKPY 358
            |.||.:....|..|   ||
plant   234 LTVATFCYLQFFPP---PY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 53/163 (33%)
LPP2NP_172961.1 PLN02250 1..290 CDD:215139 84/279 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.