DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and LPP4

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_566602.1 Gene:LPP4 / 821350 AraportID:AT3G18220 Length:308 Species:Arabidopsis thaliana


Alignment Length:268 Identity:78/268 - (29%)
Similarity:128/268 - (47%) Gaps:60/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFCDD--ESLKHPFHDSTVRNWMLYFIGAVIPVG 149
            ||    |.|||:..|...::..:: ||:.| :...|  ..|..||::.|:..|.:..|..::|: 
plant    23 LC----DWLILVVLGLIDIVLNVI-EPFHR-YIGPDMLTDLTFPFYEDTIPMWAVPIICILVPI- 80

  Fly   150 VIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSI 214
            .||||                    |.:...::.|..   :..:|| .|..:::.:|||..|.::
plant    81 CIFIV--------------------YYYYRRDVYDLH---HAILGI-GFSCLVTGVTTDSIKDAV 121

  Fly   215 GRLRPHFIAVCQPQMADGSTCDDAINAGK-----YIQEFTCKGVGSSARMLKEMRLSFPSGHSSF 274
            ||.||:|...|.|.             ||     ..::..|.||   .:::||...||||||:|:
plant   122 GRPRPNFFYRCFPN-------------GKPKFHPDTKDVVCHGV---KKIIKEGYKSFPSGHTSW 170

  Fly   275 TFFAMVYLALYLQARMTW--RGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSI 337
            :|..:.:||.||..::..  |...:.:..|.||.|:::....:|||.||.|||:||.||::||  
plant   171 SFAGLTFLAWYLSGKIKVFDRRGHVAKLCLVFLPILISILIGISRVDDYWHHWTDVFAGAIIG-- 233

  Fly   338 SALVVANY 345
              :.||::
plant   234 --IFVASF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 52/161 (32%)
LPP4NP_566602.1 PgpB 23..246 CDD:223743 78/268 (29%)
PAP2_containing_1_like 55..244 CDD:239484 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.