DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and LPP3

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_566177.1 Gene:LPP3 / 821299 AraportID:AT3G02600 Length:364 Species:Arabidopsis thaliana


Alignment Length:330 Identity:82/330 - (24%)
Similarity:142/330 - (43%) Gaps:55/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SRQTTVNSNNNNYSNSVQVRLQEQDRDSDSEQQQHTATITMDTNKRILCRVGLD---VLILLCAG 101
            :|...::...:|:.:...:.|.|.:......::......|:.::...:.|..:.   :|:||...
plant    21 NRGPEISETADNWVSPSDIPLIEPNSKEHRMREAQLGGHTLRSHGMTVARTHMHDWIILVLLVIL 85

  Fly   102 FPILLFFLLGEPYKRGFFCDD--ESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAK 164
            ..:||..   .|:.| |...|  ..|.:|...:||..|.:.....::|: ||||           
plant    86 ECVLLII---HPFYR-FVGKDMMTDLSYPLKSNTVPIWSVPVYAMLLPL-VIFI----------- 134

  Fly   165 QDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQM 229
                        |:.:...|.....:..:|: .:..:::.:.||..|.::||.||.|...|.|  
plant   135 ------------FIYFRRRDVYDLHHAVLGL-LYSVLVTAVLTDAIKNAVGRPRPDFFWRCFP-- 184

  Fly   230 ADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM---T 291
             ||....|::.      :..|.|..|   :::|...||||||:|::|..:.:|:|||..::   .
plant   185 -DGKALYDSLG------DVICHGDKS---VIREGHKSFPSGHTSWSFSGLGFLSLYLSGKIQAFD 239

  Fly   292 WRG--SKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIG-SISALVVANYVSDLFQKP 353
            .:|  :||...:|..||   |....:|||.||.|||.||.||.|:| :||.:....:....:...
plant   240 GKGHVAKLCIVILPLLF---AALVGISRVDDYWHHWQDVFAGGLLGLAISTICYLQFFPPPYHTE 301

  Fly   354 NTKPY 358
            ...||
plant   302 GWGPY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 53/160 (33%)
LPP3NP_566177.1 PLN02731 1..364 CDD:178332 82/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.