DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and SGPP1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_110418.1 Gene:SGPP1 / 81537 HGNCID:17720 Length:441 Species:Homo sapiens


Alignment Length:228 Identity:48/228 - (21%)
Similarity:71/228 - (31%) Gaps:72/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 VRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIG---- 194
            |.||.||.:       ..|..|:           ||.     :|.....|.|:......:|    
Human   123 VSNWPLYCL-------FCFGTEL-----------GNE-----LFYILFFPFWIWNLDPLVGRRLV 164

  Fly   195 -IYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSAR 258
             |:.....|.|.|.||.::.    ||....|.:.::.             |..|:          
Human   165 VIWVLVMYLGQCTKDIIRWP----RPASPPVVKLEVF-------------YNSEY---------- 202

  Fly   259 MLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAW--YTALSRVSDY 321
                   |.||.|:.......:.:.|....|  |:     ..|:..|.::..|  ...|||:...
Human   203 -------SMPSTHAMSGTAIPISMVLLTYGR--WQ-----YPLIYGLILIPCWCSLVCLSRIYMG 253

  Fly   322 KHHWSDVLAGSLIGSISALVVANYVSDLFQKPN 354
            .|...|::||.|. :|..|.|.....||....|
Human   254 MHSILDIIAGFLY-TILILAVFYPFVDLIDNFN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 32/161 (20%)
SGPP1NP_110418.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..110
PAP2_SPPase1 126..275 CDD:239482 43/213 (20%)
Phosphatase sequence motif I. /evidence=ECO:0000305 178..186 2/11 (18%)
Phosphatase sequence motif II. /evidence=ECO:0000305 205..208 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 248..259 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.