DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and PLPPR3

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_079164.1 Gene:PLPPR3 / 79948 HGNCID:23497 Length:746 Species:Homo sapiens


Alignment Length:359 Identity:91/359 - (25%)
Similarity:145/359 - (40%) Gaps:99/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TMDTNKRILCRVGLDVLILL-CAGF---PIL------LFFL----LGEPYKRGFFCDDESLKHPF 129
            |.:.||     :..|.:.|| |..|   ||:      |:||    |.:|.|.||.|.|.:|..|:
Human     4 TKEKNK-----IPKDSMTLLPCFYFVELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRTLSMPY 63

  Fly   130 ---HDSTVRNWMLYFIGAVIPVGVIFIVEVII------------------SQNKAKQDNGNATSR 173
               ::..:...||..:....|...|.:.|.::                  ....|...|.|:..|
Human    64 VETNEELIPLLMLLSLAFAAPAASIMVAEGMLYCLQSRLWGRAGGPAGAEGSINAGGCNFNSFLR 128

  Fly   174 RYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMA-DGSTCDD 237
            |.|              :.:|::.||...:.|.||:.:.:.|...|.|:.||:|... .|::|: 
Human   129 RTV--------------RFVGVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCE- 178

  Fly   238 AINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALY------LQARMTWRG-- 294
               ...||.:..|.  |.....:...|.:|||.|::.:.||.||:::.      .||.:..||  
Human   179 ---VNPYITQDICS--GHDIHAILSARKTFPSQHATLSAFAAVYVSVSPAPHCPSQALLLTRGEP 238

  Fly   295 -------------------SKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGS-ISA 339
                               :|||:.:|.|.|.:.|....|::::.|:.|..||.||.|||: |:|
Human   239 SLTPTPMPQMYFNSVISDTTKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFLIGAGIAA 303

  Fly   340 LVVANYVSDLFQKPNTKPYLARTVQDMNASPAQA 373
            .:..:.|.:....|..||          |:||.|
Human   304 YLACHAVGNFQAPPAEKP----------AAPAPA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 50/183 (27%)
PLPPR3NP_079164.1 PAP2_wunen 129..306 CDD:239479 52/196 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.