DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and LOC794598

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_001334589.3 Gene:LOC794598 / 794598 -ID:- Length:293 Species:Danio rerio


Alignment Length:270 Identity:120/270 - (44%)
Similarity:158/270 - (58%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVG 149
            |.|.||.:||..:|.||.|..:..:...|:||||||.|:|:::||.:.|:...:|  :|.:||:.
Zfish    20 RGLWRVCVDVSCVLLAGLPFAVLNIQHRPFKRGFFCSDDSIRYPFKEDTISYQLL--MGIMIPLA 82

  Fly   150 VIFIVEVIISQNKAKQDNGNATS---RRYVFMNYELPDWMIEC-YKKIGIYAFGAVLSQLTTDIA 210
            ::.||            .|...|   |.....:||    .:.| ||.:|.:.|||.:||..||||
Zfish    83 LLLIV------------FGECFSIYLRSRASFSYE----YVACVYKAVGSFVFGAAVSQSLTDIA 131

  Fly   211 KYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFT 275
            ||:||||||||:.||:|..   |..|  ..|| ||:.|||.|   ...:..|.||||.||||||:
Zfish   132 KYTIGRLRPHFLTVCKPHW---SLID--CKAG-YIENFTCTG---DPTLTNEGRLSFYSGHSSFS 187

  Fly   276 FFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISAL 340
            .:.|::||||||:||....::|:|..|||..|..:.|..|||||||||||||||.|.:.|:..||
Zfish   188 MYCMLFLALYLQSRMRAGWARLVRPTLQFSLIAASLYVGLSRVSDYKHHWSDVLTGLIQGAAVAL 252

  Fly   341 VVANYVSDLF 350
            .....|||||
Zfish   253 FTVFCVSDLF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 82/155 (53%)
LOC794598XP_001334589.3 PAP2_wunen 110..255 CDD:239479 81/153 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577784
Domainoid 1 1.000 160 1.000 Domainoid score I4013
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3720
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm6463
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 1 1.000 - - X571
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.