DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr5

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001292380.1 Gene:Plppr5 / 75769 MGIID:1923019 Length:321 Species:Mus musculus


Alignment Length:253 Identity:72/253 - (28%)
Similarity:125/253 - (49%) Gaps:40/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RGFFCDDESLKHPF----HDSTVRNWMLYFIGAVIPVGVIFIVE-VIISQNKAKQDNGNATSRRY 175
            :||||.|.:.:.|:    ..|.|...:||.:.|.:||.||.:.| .:.....|.:|         
Mouse    41 QGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRD--------- 96

  Fly   176 VFMNYELPDWMIEC----------YKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMA 230
             |.|.|......:|          .:.:||||||...:.:..:..:...|.|.|||:|:|:|...
Mouse    97 -FENQEKTILTGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYT 160

  Fly   231 DGSTCDDAINAGKYIQ----EFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMT 291
                   |:...:|.|    |..|.|   :..::...|.:|||..::.:.:|..||.:|:.:.:.
Mouse   161 -------ALGCQQYTQFISGEEACTG---NPDLIMRARKTFPSKEAALSVYAATYLTMYITSTIK 215

  Fly   292 WRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIG-SISALVVANYVSD 348
            .:|::|.:.:|....:.:|:.|.|:||::|::|||||:||.|:| ||:..:|...|::
Mouse   216 AKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFLVVCVVNN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 49/169 (29%)
Plppr5NP_001292380.1 PAP2_wunen 118..267 CDD:239479 48/158 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834772
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.