DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plpp5

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_017455732.1 Gene:Plpp5 / 680466 RGDID:1591734 Length:316 Species:Rattus norvegicus


Alignment Length:245 Identity:74/245 - (30%)
Similarity:100/245 - (40%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 MLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVL 202
            :|..|..:.|:.:||..:.:   .||     :||..:...:...|                ...|
  Rat   111 LLQVIAFLTPLSLIFFAKFL---RKA-----DATDSKQACLAASL----------------ALAL 151

  Fly   203 SQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSF 267
            :.:.|:|.|..:||.||.|...|.|   ||....|          .||.|   ...::.|.|.||
  Rat   152 NGVFTNIIKLIVGRPRPDFFYRCFP---DGMAHSD----------LTCTG---DKDVVNEGRKSF 200

  Fly   268 PSGHSSFTFFAMVYLALYLQARM----------TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYK 322
            |||||||.|..:.:.:.||..::          :||   |...|...||..|   .||||..|||
  Rat   201 PSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR---LCAFLSPLLFAAV---IALSRTCDYK 259

  Fly   323 HHWSDVLAGSLIGSISALV-VANYVSDLFQKPNTKPYLARTVQDMNASPA 371
            |||.|||.||:||:..|.| ...|...|......||:     ||.:..|:
  Rat   260 HHWQDVLVGSMIGTTFAYVCYRQYYPPLTDTECHKPF-----QDKHRLPS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 57/165 (35%)
Plpp5XP_017455732.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.