DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Dolpp1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_065062.1 Gene:Dolpp1 / 57170 MGIID:1914093 Length:238 Species:Mus musculus


Alignment Length:148 Identity:43/148 - (29%)
Similarity:63/148 - (42%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 AINAG------KYIQE-FTCKG----VGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMT 291
            |:|.|      ..||| ..|.|    ||:        :...||.||.|.:|..||..|:|..||.
Mouse    67 ALNQGVNWLIKHVIQEPRPCGGPHTAVGT--------KYGMPSSHSQFMWFFSVYSFLFLYLRMH 123

  Fly   292 WRGSK-----LLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISA----LVVANYVS 347
            ...:.     |.||:|....:..|:..:.|||....|.||.|..|.:.||:.|    ::....::
Mouse   124 QTNNARFLDLLWRHVLSLGLLTAAFLVSYSRVYLLYHTWSQVFYGGVAGSLMAVAWFIITQEILT 188

  Fly   348 DLFQK----PNTKPYLAR 361
            .||.:    |.::.:|.|
Mouse   189 PLFPRIAAWPISEFFLIR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 38/124 (31%)
Dolpp1NP_065062.1 PgpB 9..184 CDD:223743 38/124 (31%)
PAP2_dolichyldiphosphatase 16..180 CDD:239477 38/120 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.