DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and ppap2d

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001073447.1 Gene:ppap2d / 559124 ZFINID:ZDB-GENE-061201-42 Length:323 Species:Danio rerio


Alignment Length:335 Identity:123/335 - (36%)
Similarity:184/335 - (54%) Gaps:54/335 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 TVNSNNNNYSNSVQVRLQEQDRDSDSEQQQHTATI-----TMDT----NKRILCRVGLDVLILLC 99
            :|||.|    :.:|.||.:.....::.::..|..|     .:||    ::::|  ||||:|.||.
Zfish     6 SVNSMN----SELQQRLADNGGSGEAARENGTKHILSPAEPVDTVQCSSRKML--VGLDILCLLV 64

  Fly   100 AGFPILLFFLLG-EPYKRGFFCDDESLKHPF------HDSTVRNWMLYFIGAVIPVGVIFIVEVI 157
            |..|.....|.. .||.|||||.|.|:.:|:      .||.:....:...|..|.||..:.|.. 
Zfish    65 ASIPFFACELKAVTPYMRGFFCGDTSITYPYIESEAIPDSVLIAGGIIITGLTIAVGECYRVRF- 128

  Fly   158 ISQNKAKQDNGNATSRRYVFMNYELPDWMIEC-YKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHF 221
                      .:..||.:|...|      :.| ||::|.:.||..:.|..|::||.|:|||||||
Zfish   129 ----------RDVHSRAFVRNLY------VSCLYKELGSFLFGCCVGQSLTNMAKLSVGRLRPHF 177

  Fly   222 IAVCQPQMADGSTCDDAINA--GKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLAL 284
            ::.|       :...:::|.  |.||....||   ||.::::|.|.||.|||:||..:.|:|||.
Zfish   178 LSAC-------NVTYESLNCTPGTYISHVVCK---SSKKIVEEARKSFFSGHASFAMYTMLYLAF 232

  Fly   285 YLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDL 349
            |||||::|:|::|||.||||:.:|:|.||.|||:|||:||.:|||.|.|.|.::|..||.|:|.:
Zfish   233 YLQARLSWQGARLLRPLLQFMLVMLAVYTGLSRISDYRHHPTDVLTGFLQGGLTAYWVAFYISSM 297

  Fly   350 FQ--KPNTKP 357
            |:  :|:..|
Zfish   298 FKTSRPDMSP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 73/157 (46%)
ppap2dNP_001073447.1 PAP2_wunen 145..291 CDD:239479 72/155 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577809
Domainoid 1 1.000 160 1.000 Domainoid score I4013
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 202 1.000 Inparanoid score I3720
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm6463
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.