DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and plppr3a

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001164499.1 Gene:plppr3a / 553336 ZFINID:ZDB-GENE-070912-555 Length:730 Species:Danio rerio


Alignment Length:264 Identity:75/264 - (28%)
Similarity:128/264 - (48%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LCAGFPILLFFL----LGEPYKRGFFCDDESLKHPF---HDSTVRNWMLYFIGAVIPVGVIFIVE 155
            :.|...|.|:||    :.:|.|.||.|.|.:|..|:   .|..:...||..:....|...|.:.|
Zfish    47 IVASSMISLYFLELTDVLQPAKVGFRCHDRTLSMPYVETGDELIPLLMLLSLAFAGPAASIMLGE 111

  Fly   156 VII--SQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLR 218
            .::  .|:|.|..:|:..|......|:.  .::....:.:|::.||...:.|.||:.:.:.|...
Zfish   112 ALMYCMQSKLKIRSGSEGSINAGGCNFN--SFLRRTVRFVGVHVFGLCATALVTDVIQLATGYHA 174

  Fly   219 PHFIAVCQPQMA-DGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYL 282
            |.|:.||:|... .|..||    ...||.:..|.|....|  :...|.:|||.|::.:.||.||:
Zfish   175 PFFLTVCKPNYTLPGVACD----KNPYITQDICSGRDQYA--ILSARKTFPSQHATLSGFAAVYI 233

  Fly   283 ALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVS 347
            ::|..|.:: ..:|||:.:|.|.|.:.|...:|::::.|:.|..||..|.:||:..|:.:|.|..
Zfish   234 SMYFNATIS-DSTKLLKPVLVFAFAIAAALASLTQITQYRSHPIDVYVGFVIGAGIAVYLALYAV 297

  Fly   348 DLFQ 351
            ..|:
Zfish   298 GNFR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 47/155 (30%)
plppr3aNP_001164499.1 PAP2_wunen 144..293 CDD:239479 47/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.