DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and CG11425

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:259 Identity:104/259 - (40%)
Similarity:153/259 - (59%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LDVLILLCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEV 156
            |.:||:|...|.    .|.|.|.|||||||||||.:|:|::||...:|:::|..:|:..:.::|.
  Fly    20 LGLLIVLVENFR----RLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLES 80

  Fly   157 IISQNKAKQDNGNATSRRYVFMNYELPDW--MIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRP 219
            .:|..|                  ::..|  :...|..:..:.:|.|.:.|...|.|.::|||||
  Fly    81 FLSHRK------------------DMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRP 127

  Fly   220 HFIAVCQPQMADGSTCDDAINAG--KYIQEFTCKGVGSSA--RMLKEMRLSFPSGHSSFTFFAMV 280
            ||.|||.|...|||:|.|..:.|  ||..::.|:...|.|  .|::::.:|||||||:..|:.:|
  Fly   128 HFFAVCSPHFPDGSSCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLV 192

  Fly   281 YLALYLQARMTW--RGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVV 342
            ::||:|: |..|  ||| ||..:||...:.:||:.|:|||.|||||||||.||||:|:.|||.|
  Fly   193 FVALHLR-RRRWPLRGS-LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSALAV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 74/161 (46%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 74/161 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468186
Domainoid 1 1.000 47 1.000 Domainoid score I11977
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 1 0.950 - 0 Normalized mean entropy S2766
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.