DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and CG11437

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_649393.1 Gene:CG11437 / 40470 FlyBaseID:FBgn0037165 Length:305 Species:Drosophila melanogaster


Alignment Length:283 Identity:95/283 - (33%)
Similarity:149/283 - (52%) Gaps:16/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 NKRILCRVGLDVLILL-CAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVI 146
            |.|:|.|:.:|.|||| ..|..:::........:|||.|.|.|||:|:....:....|......:
  Fly     6 NTRLLSRLVIDFLILLGIYGAALVVLPQQLSTAQRGFHCSDTSLKYPYRQPWLTKVHLTIAVVAL 70

  Fly   147 PVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAK 211
            |...:.:||::   ..|...:....::|:||:...:|.::.||||.||:|.||..|:.....:.|
  Fly    71 PAAFVLVVEML---RAAVVPSSTELTQRFVFVGVRIPRFISECYKAIGVYLFGLGLTLAAIRLTK 132

  Fly   212 YSIGRLRPHFIAVCQPQMA--DGSTCDD--AINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHS 272
            :|.|||||:|..:|||...  .|.:|.|  |.|:..|:::|:|....:|..:|..:|.|||||..
  Fly   133 HSTGRLRPYFFDICQPTWGTEGGESCSDVTAQNSTLYLEDFSCTEFAASQDLLALVRHSFPSGFV 197

  Fly   273 SFTFFAMVYLALYLQARMTWRGSKLLRHLLQF----LFIMVAWYTALSRVSDYKHHWSDVLAGSL 333
            |.|.:||.:|..|.|||:.....:|:|..||.    |.::|.|    .|:|.|::|.:||.||:.
  Fly   198 STTCYAMGFLIFYSQARLFAPWLRLVRASLQLACCSLALVVCW----ERISTYQNHLTDVAAGAA 258

  Fly   334 IGSISALVVANYVSDLFQKPNTK 356
            :|...|.....:|:.||.:...|
  Fly   259 LGGWMAFFATVFVAHLFVEVRVK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 63/162 (39%)
CG11437NP_649393.1 PAP2_wunen 109..268 CDD:239479 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1868
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - otm46697
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.