DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and CG11438

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001287145.1 Gene:CG11438 / 40469 FlyBaseID:FBgn0037164 Length:341 Species:Drosophila melanogaster


Alignment Length:294 Identity:120/294 - (40%)
Similarity:172/294 - (58%) Gaps:23/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVI 151
            |.|...|:||.:......:|...:|.|::|||||.||:|.:|..|.|:.:.::..|...:|..||
  Fly     7 LARGFCDLLIWVALSVASVLLHKMGRPFRRGFFCGDETLSYPARDGTISSKVIIAIVLGVPNAVI 71

  Fly   152 FIVEVI-------ISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDI 209
            .:||:.       :.:...|:|:.....|..|.            |:::..|.:|..:...||.:
  Fly    72 VVVELFRQLPGGPLREAGGKRDSCRIAHRLGVL------------YRQVIFYLYGLAMVTFTTML 124

  Fly   210 AKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSF 274
            .|..:|||||||:|||||.:.|||:|.||.|.|:||..|||.....:....||:..||||||:|.
  Fly   125 TKLCLGRLRPHFLAVCQPMLPDGSSCQDAQNLGRYIDSFTCSNANMTDYQFKELYQSFPSGHASM 189

  Fly   275 TFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISA 339
            ..:||:|||:||||.::.|.||||:|||||||:|..||.:|:|:.||.|||||||||:.:|.:.|
  Fly   190 AMYAMLYLAIYLQAALSTRVSKLLKHLLQFLFVMFGWYVSLTRIIDYYHHWSDVLAGAALGVVFA 254

  Fly   340 LVVANYVSDLF---QKPNTKPYLARTVQDMNASP 370
            .:.:.||:|||   :.|.| .|.|.|::....||
  Fly   255 WLTSAYVADLFAGKRWPKT-GYSANTLRKPQVSP 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 79/154 (51%)
CG11438NP_001287145.1 PAP2_wunen 104..257 CDD:239479 79/164 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468198
Domainoid 1 1.000 160 1.000 Domainoid score I4013
eggNOG 1 0.900 - - E1_COG0671
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I2600
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 1 1.000 - - FOG0000694
OrthoInspector 1 1.000 - - mtm6463
orthoMCL 1 0.900 - - OOG6_100228
Panther 1 1.100 - - P PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X571
1110.800

Return to query results.
Submit another query.