DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr3

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_853665.2 Gene:Plppr3 / 314614 RGDID:727823 Length:716 Species:Rattus norvegicus


Alignment Length:303 Identity:84/303 - (27%)
Similarity:137/303 - (45%) Gaps:65/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LCAGFPILLFFL----LGEPYKRGFFCDDESLKHPF---HDSTVRNWMLYFIGAVIPVGVIFIVE 155
            :.|...:.|:||    |.:|.|.||.|.|.||..|:   ::..:...||..:....|...|.:.|
  Rat    28 IVASSVVSLYFLELTDLFQPAKVGFQCHDRSLSMPYVETNEELIPLLMLLSLAFAAPAASIMVGE 92

  Fly   156 --VIISQNK--------------AKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQ 204
              |...|::              |...|.|:..||.|              :.:|::.||...:.
  Rat    93 GMVYCLQSRLWGRGPGGVEGSINAGGCNFNSFLRRTV--------------RFVGVHVFGLCATA 143

  Fly   205 LTTDIAKYSIGRLRPHFIAVCQPQMA-DGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFP 268
            |.||:.:.:.|...|.|:.||:|... .|::|:    |..||.:..|.|..:.|  :...|.:||
  Rat   144 LVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCE----ANPYITQDICSGHDTHA--ILSARKTFP 202

  Fly   269 SGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSL 333
            |.|::.:.||.||:::|..:.:: ..:|||:.:|.|.|.:.|....|::::.|:.|..||.||.|
  Rat   203 SQHATLSAFAAVYVSMYFNSVIS-DATKLLKPILVFAFAIAAGVCGLTQITQYRSHPVDVYAGFL 266

  Fly   334 IGS-ISALVVANYVSDLFQKPNTKPYLA-RTVQDMNASPAQAI 374
            ||: |:|                  ||| ..|.:..||||:.:
  Rat   267 IGAGIAA------------------YLACHAVGNFQASPAEKV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 49/156 (31%)
Plppr3NP_853665.2 PAP2_wunen 127..276 CDD:239479 52/187 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 664..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.