DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr2

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_006242690.1 Gene:Plppr2 / 300443 RGDID:1597171 Length:452 Species:Rattus norvegicus


Alignment Length:305 Identity:72/305 - (23%)
Similarity:136/305 - (44%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILCRVGLDVLILLCAGFPILLFFLLG-----EPYKRGFFCDDESLKHPFHD----STVRNWMLYF 141
            |.|.|.::.::|   |..|||.:.|.     ..:.:||||.|.:...|:..    |.....::|.
  Rat    15 IPCFVFVESVLL---GIVILLAYRLEFTDTFPVHTQGFFCYDSAYAKPYPGPEAASRAPPALIYA 76

  Fly   142 IGAVIPVGVIFIVEV----IISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVL 202
            :....|...|.:.|:    ..:...|...:|.:|........:..|  :....:.:|:|:||...
  Rat    77 LVTAGPTLTILLGELARAFFPAPPSASPVSGESTIVSGACCRFSPP--LRRLVRFLGVYSFGLFT 139

  Fly   203 SQLTTDIAKYSIGRLRPHFIAVCQPQ---MADGSTCDDAINAGKYI-QEFTCKGVGSSARMLKEM 263
            :.:..:..:...|...|||::||:|.   :.......|.....::: .:..|.|   |..::...
  Rat   140 TTIFANAGQVVTGNPTPHFLSVCRPNYTALGCPPPSPDRPGPDRFVTDQSACAG---SPSLVAAA 201

  Fly   264 RLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDV 328
            |.:||...::...:|:.|.|:|:......:||:|::..|....:..|:...:.||::|::|||||
  Rat   202 RRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDV 266

  Fly   329 LAGSLIGSISALVVANYVSDLFQKPNTKPYLARTV---QDMNASP 370
            |||.|.|:..|..:...|...||   ::|...|.:   :|::.:|
  Rat   267 LAGFLTGAAIATFLVTCVVHNFQ---SRPLSGRRLSPWEDLSQAP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 41/158 (26%)
Plppr2XP_006242690.1 PAP2_wunen 125..281 CDD:239479 41/158 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338315
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.