DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr4

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001001508.2 Gene:Plppr4 / 295401 RGDID:727806 Length:766 Species:Rattus norvegicus


Alignment Length:318 Identity:95/318 - (29%)
Similarity:143/318 - (44%) Gaps:58/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VLILLCAGF---PIL------LFFL----LGEPYKRGFFCDDESLKHPFHDST---VRNWMLYFI 142
            |.:|.|..|   |||      |:||    :.:|...||.|.|.||..|:.:.|   :...||..:
  Rat    65 VTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEAIPFLMLLSL 129

  Fly   143 GAVIPVGVIFIVEVIISQNKAKQDNG--------------NATSRRYVFMNYELPDWMIECYKKI 193
            ....|...|.:.|.|:....:|:.||              |:..||.|              :.:
  Rat   130 AFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGGCNFNSFLRRAV--------------RFV 180

  Fly   194 GIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMAD-GSTCDDAINAGKYIQEFTCKGVGSSA 257
            |::.||...:.|.|||.:.|.|...|:|:.||:|.... ..:|.:    ..||.|..|.  ||..
  Rat   181 GVHVFGLCSTALITDIIQLSTGYQAPYFLTVCKPNYTSLNVSCKE----NSYIVEDICS--GSDL 239

  Fly   258 RMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYK 322
            .::...|.||||.|::...||.||:::|..:.:| ..||||:.||.|.||:......|:|::.||
  Rat   240 TVINSGRKSFPSQHATLAAFAAVYVSMYFNSTLT-DSSKLLKPLLVFTFIICGIICGLTRITQYK 303

  Fly   323 HHWSDVLAGSLIGSISALVVANYVSDLFQKPNTKPYL-----ARTVQDMNASPAQAIT 375
            :|..||..|.|||...||.:..|....| .|:....|     .|::.|:|..|::.::
  Rat   304 NHPVDVYCGFLIGGGIALYLGLYAVGNF-LPSEDSMLQHRDALRSLTDLNQDPSRVLS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 55/155 (35%)
Plppr4NP_001001508.2 PAP2_wunen 175..324 CDD:239479 57/169 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..503
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 672..705
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 741..766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.