DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_848871.1 Gene:Plppr1 / 272031 MGIID:2445015 Length:325 Species:Mus musculus


Alignment Length:312 Identity:80/312 - (25%)
Similarity:146/312 - (46%) Gaps:48/312 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILCRVGLDVLILLCAGFPILLFFL----LGEPYKRGFFCDDESLKHPF----HDSTVRNWMLYFI 142
            |.|.:.::::|:  ||..:|.::.    ..:.:.:||||.|..|..|:    .:|.:...:||.:
Mouse    14 IPCFIFVELVIM--AGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFISPLVLYCV 76

  Fly   143 GAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECY---------KKIGIYAF 198
            .|..|..:|||.|:.:...|:.:::..|..:..:..:.        ||         :.||::||
Mouse    77 LAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDC--------CYLSPLLRRIIRFIGVFAF 133

  Fly   199 GAVLSQLTTDIAKYSIGRLRPHFIAVCQPQ--MADGSTCDDAINAGKYIQEFTCKGVGSSARMLK 261
            |...:.:..:..:...|.|.|:|:.||||.  ..|.......||.|.     .|.|   ...:::
Mouse   134 GLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHQQFINNGN-----ICTG---DLEVIE 190

  Fly   262 EMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWS 326
            :.|.||||.|::.:.::.:|..:|:.:.:..:.|:|.:.:|....:..|:.|.|:|||:|::|.|
Mouse   191 KARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCS 255

  Fly   327 DVLAGSLIGSISAL-----VVANYVSDLFQKPNTKPYLARTVQDMNASPAQA 373
            ||:||.::|:..||     ||.|:..........||      :|....|..|
Mouse   256 DVIAGFILGTAVALFLGMCVVHNFRGTQGSPSKPKP------EDPRGVPLMA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 49/170 (29%)
Plppr1NP_848871.1 PAP2_wunen 123..272 CDD:239479 46/156 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834765
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.