DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and Plppr3

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_859009.2 Gene:Plppr3 / 216152 MGIID:2388640 Length:716 Species:Mus musculus


Alignment Length:291 Identity:82/291 - (28%)
Similarity:134/291 - (46%) Gaps:54/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ILLCAGF---PIL------LFFL----LGEPYKRGFFCDDESLKHPF---HDSTVRNWMLYFIGA 144
            :|.|..|   ||:      |:||    |.:|.|.||.|.|.:|..|:   ::..:...||..:..
Mouse    17 LLPCFYFVELPIVASSIVSLYFLELTDLFKPAKVGFQCYDRALSMPYVETNEELIPLLMLLSLAF 81

  Fly   145 VIPVGVIFIVE--VIISQNK--------------AKQDNGNATSRRYVFMNYELPDWMIECYKKI 193
            ..|...|.:.|  |...|::              |...|.|:..||.|              :.:
Mouse    82 AAPAASIMVGEGMVYCLQSRLWGRGPGGVEGSINAGGCNFNSFLRRTV--------------RFV 132

  Fly   194 GIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMA-DGSTCDDAINAGKYIQEFTCKGVGSSA 257
            |::.||...:.|.||:.:.:.|...|.|:.||:|... .|::|:    :..||.:..|.|..:.|
Mouse   133 GVHVFGLCATALVTDVIQLATGYHTPFFLTVCKPNYTLLGTSCE----SNPYITQDICSGHDTHA 193

  Fly   258 RMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYK 322
              :...|.:|||.|::.:.||.||:::|..|.:: ..:|||:.:|.|.|.:.|....|::::.|:
Mouse   194 --ILSARKTFPSQHATLSAFAAVYVSMYFNAVIS-DTTKLLKPILVFAFAIAAGVCGLTQITQYR 255

  Fly   323 HHWSDVLAGSLIGSISALVVANYVSDLFQKP 353
            .|..||.||.|||:..|..:|.:....||.|
Mouse   256 SHPVDVYAGFLIGAGIAAYLACHAVGNFQAP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 48/155 (31%)
Plppr3NP_859009.2 PAP2_wunen 127..276 CDD:239479 50/169 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 416..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 630..651
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 663..693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834786
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.