DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and PLPP4

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001025230.1 Gene:PLPP4 / 196051 HGNCID:23531 Length:271 Species:Homo sapiens


Alignment Length:290 Identity:77/290 - (26%)
Similarity:121/290 - (41%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KRILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFCDDESL-KHPFHDS-TVRNWMLYFIGAVI 146
            :.:...:|:..|:     |.:.:|....:|::|....::..| |:|...| .:...:::.|..:.
Human     2 RELAIEIGVRALL-----FGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLT 61

  Fly   147 PVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAK 211
            |:.||.:|::|...:|        |..:..|:...|                ...|:.:.|:..|
Human    62 PLAVICVVKIIRRTDK--------TEIKEAFLAVSL----------------ALALNGVCTNTIK 102

  Fly   212 YSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTF 276
            ..:||.||.|...|.|        |..:|:     |..|.|   ...::.|.|.||||.||||.|
Human   103 LIVGRPRPDFFYRCFP--------DGVMNS-----EMHCTG---DPDLVSEGRKSFPSIHSSFAF 151

  Fly   277 FAMVYLALYLQARM-----TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGS 336
            ..:.:...||..::     :.|| |..|.....|.:..|...||||:.||||||.|...|.:||.
Human   152 SGLGFTTFYLAGKLHCFTESGRG-KSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGL 215

  Fly   337 ISALVVANYVSDLFQKPNT---KPYLARTV 363
            |.|.:.  |........||   |||::..|
Human   216 IFAYIC--YRQHYPPLANTACHKPYVSLRV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 50/159 (31%)
PLPP4NP_001025230.1 PAP2_containing_1_like 37..225 CDD:239484 65/230 (28%)
Phosphatase sequence motif I. /evidence=ECO:0000269|PubMed:17590538 102..110 3/7 (43%)
Phosphatase sequence motif II. /evidence=ECO:0000269|PubMed:17590538 143..146 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000269|PubMed:17590538 195..205 7/9 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.670

Return to query results.
Submit another query.