DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and plpr-1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_496399.1 Gene:plpr-1 / 174710 WormBaseID:WBGene00011524 Length:396 Species:Caenorhabditis elegans


Alignment Length:309 Identity:80/309 - (25%)
Similarity:129/309 - (41%) Gaps:60/309 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHDSTVRNW------------M 138
            |.|...|...:...:.||.         :.|.|:|.|..|..|       |:            :
 Worm    48 IACLAALWYYLRFTSVFPY---------HHRVFYCRDVHLYKP-------NFVPEDFNVYVSYPL 96

  Fly   139 LYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNY-ELPDWMI--ECYKKIGIYAFGA 200
            ||.:...||..||.|.||:......|       .|:.|:.|. |.|..:.  ..::.:.||..|.
 Worm    97 LYTLAFTIPPLVILIGEVMFWLFSTK-------PRKIVYANCGECPVHLFTRRLFRFVIIYLAGL 154

  Fly   201 VLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAI-NAGKYIQEFTCKGVGSSARMLKEMR 264
            ::.|:..|..|...|..||:|:::|...:   :.|...: ::........|...|:.     |:|
 Worm   155 LIVQIFVDTIKLMTGYQRPYFLSLCNVSI---TACTAPLEHSPSPSPHLACNYRGAD-----ELR 211

  Fly   265 ---LSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWS 326
               |:|||.|:..:.:|..:.:||:...:..||:.|||.||.|.|:.:....:.||::.||:||.
 Worm   212 YAWLTFPSLHAVVSSYAACFASLYIYYMINLRGAPLLRPLLIFGFMGLCIVDSFSRINGYKNHWR 276

  Fly   327 DVLAGSLIGSISALVVANYVSDLFQKPNTKPY---LART--VQDMNASP 370
            |:....:||...|..:. |....||    :.|   :.||  ||:...||
 Worm   277 DIWVAWVIGIFMAWFLC-YCVLCFQ----EVYHMTIERTPIVQEERVSP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 43/158 (27%)
plpr-1NP_496399.1 PAP2_wunen 142..293 CDD:239479 43/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.