DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and SGPP2

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_689599.2 Gene:SGPP2 / 130367 HGNCID:19953 Length:399 Species:Homo sapiens


Alignment Length:227 Identity:48/227 - (21%)
Similarity:73/227 - (32%) Gaps:89/227 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 VRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELP--DWMIECY---KKI 193
            |:|:..|:         :|.....:.|.              ||....||  .|.|:.|   :.|
Human    81 VKNYFYYY---------LFQFSAALGQE--------------VFYITFLPFTHWNIDPYLSRRLI 122

  Fly   194 GIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSAR 258
            .|:.....:.|:..|:.|:.    ||                                   ||..
Human   123 IIWVLVMYIGQVAKDVLKWP----RP-----------------------------------SSPP 148

  Fly   259 MLK-EMRL----SFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLF-----IMVAWYT 313
            ::| |.||    ..||.|      ||...|:    ..|...|.:.|:...|:.     ::.:...
Human   149 VVKLEKRLIAEYGMPSTH------AMAATAI----AFTLLISTMDRYQYPFVLGLVMAVVFSTLV 203

  Fly   314 ALSRVSDYKHHWSDVLAGSLIGSISALVVANY 345
            .|||:....|...|||.|.||.::  |:|..|
Human   204 CLSRLYTGMHTVLDVLGGVLITAL--LIVLTY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 35/167 (21%)
SGPP2NP_689599.2 PAP2_SPPase1 84..233 CDD:239482 45/222 (20%)
Phosphatase sequence motif I. /evidence=ECO:0000305 136..144 2/11 (18%)
Phosphatase sequence motif II. /evidence=ECO:0000305 163..166 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 206..217 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.