DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and plpp5

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001121478.1 Gene:plpp5 / 100158576 XenbaseID:XB-GENE-5812193 Length:266 Species:Xenopus tropicalis


Alignment Length:293 Identity:82/293 - (27%)
Similarity:119/293 - (40%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LDVLIL--LCAGFPILLFFLLGEPYKRGFFCDDESLKHPFHD--STVRNWML---YFIGAVIPVG 149
            :|..||  ..|.|.|.|..|       |.|...|:: |||..  .....|:.   |.:...:|..
 Frog     1 MDKRILEGFVAEFIIRLLLL-------GIFLISETM-HPFERLIQPEEMWLYRNPYVVSDRVPTN 57

  Fly   150 VIFIVE-------VIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYA-FGAVLSQLT 206
            .:|::.       |::::...|.||.:|                    ::.|:.| ....|:.:.
 Frog    58 SMFLISFLTPLLVVVLARVFWKADNTDA--------------------REAGLAASLSLALNGIF 102

  Fly   207 TDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLKEMRLSFPSGH 271
            |:..|..:||.||.|::.|.|.             |:...||.|.|   ...::.|.|.||||||
 Frog   103 TNTVKLIVGRPRPDFLSRCFPD-------------GRESPEFHCTG---DPELVIEGRKSFPSGH 151

  Fly   272 SSFTFFAMVYLALYLQARM----------TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWS 326
            :||.|..:.:.||||..::          :||....|..||..:.|      ||||..||||||.
 Frog   152 ASFAFAGLGFTALYLAGKLRCFSSYGRGHSWRLCTSLIPLLCAIAI------ALSRTCDYKHHWQ 210

  Fly   327 DVLAGSLIGSISA-LVVANYVSDLFQKPNTKPY 358
            ||:.|:.||...| |....|...|..:...:||
 Frog   211 DVVVGAFIGLFFAYLCYRQYYPPLADRDCHQPY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 55/166 (33%)
plpp5NP_001121478.1 PAP2_containing_1_like 42..230 CDD:239484 64/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.