DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and plppr1

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001096370.1 Gene:plppr1 / 100124964 XenbaseID:XB-GENE-974061 Length:325 Species:Xenopus tropicalis


Alignment Length:296 Identity:75/296 - (25%)
Similarity:145/296 - (48%) Gaps:45/296 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ITMDTNKR-----ILCRVGLDVLILLCAGFPILLFFL----LGEPYKRGFFCDDESLKHPF---- 129
            :.::||..     |.|.:.::::|:  ||..:|.::.    ..:.:.:||||.|.:|..|:    
 Frog     1 MALETNTHRSYSIIPCFIFVELVIM--AGTVLLSYYFECTDTFQVHIQGFFCQDGNLMKPYPGTE 63

  Fly   130 HDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECY---- 190
            .:|.:...:||.:.|..|..:|||.||.....|:.::  |...:..:.:..|.      ||    
 Frog    64 DESFISPLVLYCVLAATPTAIIFIGEVTTYFIKSTRE--NLIVQEKMILTGEC------CYLNPL 120

  Fly   191 -----KKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFT- 249
                 :.||::|||...:.:..:..:...|.|.|:|:.||:|..    |..|.:...::|.... 
 Frog   121 FRRIIRFIGVFAFGLFATDIFVNAGQVVTGNLTPYFLTVCKPNY----TASDCLIYHQFINSANI 181

  Fly   250 CKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTA 314
            |.|   ...::::.|.||||.|::.:.::.:|..:|:.:.:..:.|:|.:.:|....:..|:.|.
 Frog   182 CTG---DPEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCCAFLTG 243

  Fly   315 LSRVSDYKHHWSDVLAGSLIGSISAL-----VVANY 345
            |:|||:|::|..||:.|.::|:..||     ||.|:
 Frog   244 LNRVSEYRNHCVDVIGGFILGTAIALFLGLCVVHNF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 45/169 (27%)
plppr1NP_001096370.1 PAP2_wunen 123..272 CDD:239479 42/155 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.