DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun and plppr5a

DIOPT Version :9

Sequence 1:NP_724787.1 Gene:wun / 35966 FlyBaseID:FBgn0016078 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001121841.1 Gene:plppr5a / 100006660 ZFINID:ZDB-GENE-070705-281 Length:309 Species:Danio rerio


Alignment Length:305 Identity:75/305 - (24%)
Similarity:142/305 - (46%) Gaps:50/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ILLCAGFPILLFFL----LGEPYKRGFFCDDESLKHPF----HDSTVRNWMLYFIGAVIPVGVIF 152
            :::.||..:|.::.    ....:.:||||.|.:...|:    ..|.:...:||.:.|.:|..||.
Zfish     6 LVIMAGTVMLAYYFEYTDTFNVHVQGFFCHDNAYTKPYLGPEESSAIPPAILYAVVAGVPALVIT 70

  Fly   153 IVE-VIISQNKAKQDNGNATSRRYVFMNYELPDWMIEC----------YKKIGIYAFGAVLSQLT 206
            :.| |:.......:|..|   |..:.:       |.:|          ::.:|:||||...:.:.
Zfish    71 VTESVLFLLQYVSEDLDN---REKIIV-------MGDCCYLNPLVRRTFRFLGVYAFGLFATDIF 125

  Fly   207 TDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYI-QEFTCKGVGSSARMLKEMRLSFPSG 270
            .:..:...|.|.|:|:.||:|... ...|...:   ::| |:..|.|   :...:...|.||||.
Zfish   126 VNAGQVVTGNLSPYFLTVCKPNYT-ALGCQQVV---RFINQQDACTG---NEDDILHARKSFPSK 183

  Fly   271 HSSFTFFAMVYLALYLQARMTWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIG 335
            .::.:.:|.:|:|:|:...:..:|::|.:.:|....:.:|:.|.::||.:|::||:||:||.:||
Zfish   184 EAAISVYAALYVAMYITCSVKAKGTRLAKPVLSLGLMCLAFLTGINRVVEYRNHWADVIAGFIIG 248

  Fly   336 SISAL-----VVANYVSDLFQKPNTKPYLARTVQDMNASPAQAIT 375
            ...|:     ||.|:        ..||.|:....:.:.|....||
Zfish   249 GAIAVFMVVCVVKNF--------KGKPLLSEIPPEESVSSGPMIT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wunNP_724787.1 PAP2_wunen 188..343 CDD:239479 45/170 (26%)
plppr5aNP_001121841.1 PAP2_wunen 107..256 CDD:239479 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.