DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and AT3G43540

DIOPT Version :10

Sequence 1:NP_610484.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_189940.1 Gene:AT3G43540 / 823446 AraportID:AT3G43540 Length:373 Species:Arabidopsis thaliana


Alignment Length:276 Identity:53/276 - (19%)
Similarity:97/276 - (35%) Gaps:90/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 TIIICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLRWQVIDTPGILDHPLEERN 234
            ||:..|.||       :.:...|:...|.      ..|||::...|:        :|........
plant   124 TIVSSGIPN-------SNLKPGDLADLPL------FSVGHSNGALLQ--------VLTGSYFAEK 167

  Fly   235 VIEMQAITALAHLRA--CVLYFMDISEQCGHSLEEQVKLFESIKPLFTNKPLILAINK------- 290
            :.::.||.:..:..|  .|.||    ||.|..:::.:.:.|: .|::.     :|.|.       
plant   168 IPKVNAIISFNNKSATEAVPYF----EQLGPLIQQMLPMVEA-SPVYE-----MARNASGDVLKL 222

  Fly   291 -IDILTPEDLPEERRAI--ITKL----------------------QEDKN-------IPVMLMST 323
             :|......|..::.|:  .|||                      .|::|       :|..|:..
plant   223 LLDTAGTTILNNDQEALKSFTKLVDQLPSVFGEVGQGVSEFRPSPLENRNCFKCSYSVPHTLLVQ 287

  Fly   324 VQETGVMEVKTEACERLLSYRVD------QKMRTKKVDNILNRLHVAMPAPRDDKLRAPCI--PE 380
            .....:.|  |:..|..|..|::      :|:|       ||..|:. |..:|.|.:...:  |.
plant   288 FNSDAIDE--TDLLEETLRPRIESIGGTLEKVR-------LNGNHLT-PCIQDPKWQIGTVYTPA 342

  Fly   381 KASARLLQNADKAERK 396
            .|.|:.|:....:|.:
plant   343 DAVAQALKTIPLSETR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_610484.1 Nog1 6..340 CDD:440701 38/210 (18%)
NOGCT 400..448 CDD:462381
AT3G43540NP_189940.1 DUF1350 63..367 CDD:473275 53/276 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.