DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and AT3G23860

DIOPT Version :9

Sequence 1:NP_001286247.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001327821.1 Gene:AT3G23860 / 821969 AraportID:AT3G23860 Length:243 Species:Arabidopsis thaliana


Alignment Length:236 Identity:63/236 - (26%)
Similarity:100/236 - (42%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FKKI-MVVPPAKDFIDIMLSKTQRKTPTVV-----HKGYKISRIRAFYTRKVKYTQQNFHDRLSQ 64
            |||| .|||...||...:..:.|....|::     |.  .||.||..|..||........::|:.
plant    19 FKKISAVVPTELDFDRAIRFEYQIPNCTLIPDRVCHD--DISDIRQKYAVKVMSAGTTLSNKLND 81

  Fly    65 IIQDFPKLDDVHPFYADLMNVLYDKDHYKLALGQLNTARHLVDNVAKDYVRLLKYG---DSLYRC 126
            ::.:||.:..:.|.||.|::..|:..||..|:.|::..:.||:.::.:||.||:..   ||..:|
plant    82 VLHEFPCVRHLDPVYASLLHQRYNMYHYDRAVRQVSVTQTLVNVMSFNYVDLLRKDDDCDSRDKC 146

  Fly   127 KQLKKAALGRMATIMKRQASNLTYLEQVRQHLSRLPTIDPYSRTIIICGFPNVGKSSFINKITRA 191
            :.|...||.||.|..|.....|..|:|||:.::.:.              .:...:|.:||.  :
plant   147 RSLGVTALARMLTFAKSCIPALNLLDQVREFMASVE--------------DDAAATSLVNKY--S 195

  Fly   192 DV---------------EVQPYAFTTKSLYVGHTDYKYLRW 217
            ||               |...:......|.|...|.:|..|
plant   196 DVLPPEKYPFPDIVWEDETADFVDPETLLLVEELDRRYELW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_001286247.1 Nog1 5..341 CDD:224009 63/236 (27%)
NOG 169..341 CDD:206684 11/64 (17%)
NOGCT 398..448 CDD:285381
AT3G23860NP_001327821.1 Nog1 15..>178 CDD:224009 52/160 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.