DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and 128up

DIOPT Version :9

Sequence 1:NP_001286247.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_536733.1 Gene:128up / 36288 FlyBaseID:FBgn0010339 Length:368 Species:Drosophila melanogaster


Alignment Length:375 Identity:87/375 - (23%)
Similarity:139/375 - (37%) Gaps:137/375 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLRWQVIDTPGILDHPLEERNVIEMQ 239
            |||:||||:.::.:.....||..|.|||.:...|...||..:.|::|.|||::...:.:.    :
  Fly    71 GFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGCIKYKGAKIQLLDLPGIIEGAKDGKG----R 131

  Fly   240 AITALAHLRACVLYFM--DISEQCGHS--LEEQVKLFESIKPLFTNKPLILAINKIDILTPEDLP 300
            ....:|..|.|.|.||  |..:..||.  ||.:::.|.            :.:||    .|.::.
  Fly   132 GRQVIAVARTCNLIFMVLDCLKPLGHKKLLEHELEGFG------------IRLNK----KPPNIY 180

  Fly   301 EERRAIITKLQEDKNIPVMLMSTVQETGVMEVKTEACERLLS-YRVDQKMRTKKVDNILNRLHVA 364
            .:|:        ||. .:.|.|.|.::   |:.|:..:.:|| |::.....|.:.|         
  Fly   181 YKRK--------DKG-GINLNSMVPQS---ELDTDLVKTILSEYKIHNADITLRYD--------- 224

  Fly   365 MPAPRDD--------KLRAPCIPEKASARLLQNADKAERKRKLEKEIEEEMGDDYTLDLKKNYSE 421
              |..||        ::..|||      .||...|:.        .|||       ||:   ..:
  Fly   225 --ATSDDLIDVIEGNRIYIPCI------YLLNKIDQI--------SIEE-------LDV---IYK 263

  Fly   422 IPEEERYDIIP----EFWQGHNIADYIDADIFDKLEELEREEGLREESGVYKVPDMTMDETLKEI 482
            ||.     .:|    ..|.            ||.|.||                   |.|.|: :
  Fly   264 IPH-----CVPISAHHHWN------------FDDLLEL-------------------MWEYLR-L 291

  Fly   483 REIAKQIRGKRFELRDEKRLSSRKNKPVIPRNKQPKVRD------RSVQK 526
            :.|..:.:|   :|.|       .|.||:..|::..:.|      ||:.|
  Fly   292 QRIYTKPKG---QLPD-------YNSPVVLHNERTSIEDFCNKLHRSIAK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_001286247.1 Nog1 5..341 CDD:224009 44/169 (26%)
NOG 169..341 CDD:206684 44/169 (26%)
NOGCT 398..448 CDD:285381 9/53 (17%)
128upNP_536733.1 Rbg1 1..367 CDD:224085 87/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452765
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.