DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and CG10628

DIOPT Version :9

Sequence 1:NP_001286247.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609999.2 Gene:CG10628 / 35263 FlyBaseID:FBgn0032818 Length:383 Species:Drosophila melanogaster


Alignment Length:242 Identity:58/242 - (23%)
Similarity:100/242 - (41%) Gaps:67/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDYKYLR-WQVIDTPGILD--------- 227
            :.||||.|||:.:..::.|..::..|.|||....:|..:|:.|| ..|.|.||:::         
  Fly   162 LVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIEYRDLRSITVADLPGLIEGAHANFGMG 226

  Fly   228 HPLEERNVIEMQAITALAHL-RACVLYFM------DISEQCGH--------SLEEQVKLFESIKP 277
            |..             |.|: |..:|.||      .:|.:..|        :|.::::|::   |
  Fly   227 HKF-------------LKHIERTRLLVFMVDIFGFQLSPKHPHRDCLANVYALNKELELYD---P 275

  Fly   278 LFTNKPLILAINKID------ILTP------------EDLPEERRAIITKLQEDKNIPVMLMSTV 324
            ....||.:|.:||:|      |.|.            |..|||.|. ...|..|..:|:   |.:
  Fly   276 SLLEKPSVLLLNKMDKEGAHEIFTKVKPLVSDLASGLEQCPEELRP-KQVLNFDSIVPI---SAM 336

  Fly   325 QETGVMEVKTEACERLLSYRVDQKMRTKKVDNILNRL--HVAMPAPR 369
            ..:.:.:||::....|:  |:.:|......|.:..:|  .|.:..|:
  Fly   337 NSSKITQVKSQLRRTLV--RLAEKQFLADEDQVKEKLRQRVGVVGPK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_001286247.1 Nog1 5..341 CDD:224009 51/210 (24%)
NOG 169..341 CDD:206684 51/210 (24%)
NOGCT 398..448 CDD:285381
CG10628NP_609999.2 obgE 24..352 CDD:237048 51/209 (24%)
GTP1_OBG 24..>127 CDD:279370
Obg 158..352 CDD:206685 51/209 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.