DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and CG13390

DIOPT Version :9

Sequence 1:NP_001286247.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609218.1 Gene:CG13390 / 34154 FlyBaseID:FBgn0032031 Length:381 Species:Drosophila melanogaster


Alignment Length:161 Identity:47/161 - (29%)
Similarity:76/161 - (47%) Gaps:29/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDY-KYLRWQVIDTPGILDHPLEERNVI 236
            :.|:||.|||:.:|.:|||..:|.||||||...::|...| .:::..:.|.||::  |...||  
  Fly   210 LIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGLV--PDAHRN-- 270

  Fly   237 EMQAITALAHLRAC--VLYFMDIS--------EQCGHSLEEQVKLFESIKPLFTNKPLILAINKI 291
            :...|..|.|...|  :|:.:|.|        ||..|.|.:       ......::|.::..||:
  Fly   271 KGLGIQFLKHAERCTLLLFVLDASAPEPWTHYEQLMHELRQ-------FGGRLASRPQLVVANKL 328

  Fly   292 DILTPEDLPEERRAIITKLQEDKNIPVMLMS 322
            |:       ||.:....:||.....||:.:|
  Fly   329 DV-------EEGQNNFEELQRRLQNPVLGIS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_001286247.1 Nog1 5..341 CDD:224009 47/161 (29%)
NOG 169..341 CDD:206684 47/161 (29%)
NOGCT 398..448 CDD:285381
CG13390NP_609218.1 Obg_CgtA 52..366 CDD:274271 47/161 (29%)
GTP1_OBG 52..202 CDD:279370
Obg 206..368 CDD:206685 47/161 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.