DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Non1 and CG13390

DIOPT Version :10

Sequence 1:NP_610484.1 Gene:Non1 / 35963 FlyBaseID:FBgn0028473 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609218.1 Gene:CG13390 / 34154 FlyBaseID:FBgn0032031 Length:381 Species:Drosophila melanogaster


Alignment Length:161 Identity:47/161 - (29%)
Similarity:76/161 - (47%) Gaps:29/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 ICGFPNVGKSSFINKITRADVEVQPYAFTTKSLYVGHTDY-KYLRWQVIDTPGILDHPLEERNVI 236
            :.|:||.|||:.:|.:|||..:|.||||||...::|...| .:::..:.|.||::  |...||  
  Fly   210 LIGYPNAGKSTLLNALTRAKPKVAPYAFTTLRPHLGTVQYDDHVQLTIADLPGLV--PDAHRN-- 270

  Fly   237 EMQAITALAHLRAC--VLYFMDIS--------EQCGHSLEEQVKLFESIKPLFTNKPLILAINKI 291
            :...|..|.|...|  :|:.:|.|        ||..|.|.:       ......::|.::..||:
  Fly   271 KGLGIQFLKHAERCTLLLFVLDASAPEPWTHYEQLMHELRQ-------FGGRLASRPQLVVANKL 328

  Fly   292 DILTPEDLPEERRAIITKLQEDKNIPVMLMS 322
            |:       ||.:....:||.....||:.:|
  Fly   329 DV-------EEGQNNFEELQRRLQNPVLGIS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Non1NP_610484.1 Nog1 6..340 CDD:440701 47/161 (29%)
NOGCT 400..448 CDD:462381
CG13390NP_609218.1 Obg_CgtA 52..366 CDD:274271 47/161 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.