DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and LRRC46

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_005257832.1 Gene:LRRC46 / 90506 HGNCID:25047 Length:330 Species:Homo sapiens


Alignment Length:137 Identity:46/137 - (33%)
Similarity:70/137 - (51%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKG 110
            ||.:.:.:.:....|..|..|.|::.|..|.|..|.|:||..| |...:|..|.|:.|.|.:::.
Human    51 TLDELQTVRLDREGITTIRNLEGLQNLHSLYLQGNKIQQIENL-ACIPSLRFLSLAGNQIRQVEN 114

  Fly   111 LTGLKCLKVLYISNNLIKDWSEFNRLAEI-ESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRK 174
            |..|.||:.|.:|.|||    |..:|.|. :||..|.:.||..:   ::..:|....:.||.:..
Human   115 LLDLPCLQFLDLSENLI----ETLKLDEFPQSLLILNLSGNSCT---NQDGYRELVTEALPLLLD 172

  Fly   175 LDGEPVV 181
            |||:|||
Human   173 LDGQPVV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 43/134 (32%)
leucine-rich repeat 50..71 CDD:275380 4/20 (20%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 9/24 (38%)
LRRC46XP_005257832.1 LRR_8 54..109 CDD:290566 17/55 (31%)
leucine-rich repeat 55..76 CDD:275378 4/20 (20%)
LRR_4 75..115 CDD:289563 14/40 (35%)
leucine-rich repeat 77..98 CDD:275378 9/21 (43%)
LRR_8 97..151 CDD:290566 20/57 (35%)
LRR_4 97..135 CDD:289563 15/41 (37%)
leucine-rich repeat 99..120 CDD:275378 7/20 (35%)
leucine-rich repeat 121..142 CDD:275378 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.