DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and NUD1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_015018.3 Gene:NUD1 / 854555 SGDID:S000005900 Length:851 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:58/220 - (26%)
Similarity:93/220 - (42%) Gaps:49/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TTIKEALKRWEEREQQ--NSLTAKVI---DLQFQWPPIEKMDSTLGTLVQ---CER-------IS 54
            |:|.|....:.|.|:|  :.||:|:.   .....|..|.|:|.:.|.|..   .:|       ::
Yeast   442 TSISEVNTSFNETEKQLISILTSKLSGSPSYDSDWEKILKVDLSRGKLKNMFGMQRLLPNVLVLN 506

  Fly    55 MSTNMIEKIFG---------------------LSGMKCLKVLSLSRNYIKQISGLEAVAETLEEL 98
            :|.|.:..:.|                     |:|...|:.|.||.|.:.......::...|:|:
Yeast   507 LSDNEMNTLEGIPSNVVQLFCSNNKITSAHCSLAGFHDLECLDLSYNLLNTSLKFLSLCHHLQEV 571

  Fly    99 WLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGNPLS-EGLDEP--- 159
            .||||.|:.::|: |...:|.|.:|||.|....:|.:|.    |.:..|||..|: |.||..   
Yeast   572 NLSYNSIQSLEGI-GSSRMKKLNLSNNEINGIIDFEQLI----LTNNSVVGGWLTVEVLDLSNNN 631

  Fly   160 ---TWRAECIKRLPTIRKLDGEPVV 181
               .....|:.||..: .|:|.|:|
Yeast   632 IIGVRNINCLPRLKVL-NLNGNPLV 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 46/180 (26%)
leucine-rich repeat 50..71 CDD:275380 6/48 (13%)
leucine-rich repeat 95..116 CDD:275380 9/20 (45%)
leucine-rich repeat 117..141 CDD:275380 8/23 (35%)
NUD1NP_015018.3 LRR <440..662 CDD:227223 58/220 (26%)
leucine-rich repeat 522..544 CDD:275380 2/21 (10%)
leucine-rich repeat 545..567 CDD:275380 5/21 (24%)
PPP1R42 557..784 CDD:411060 32/105 (30%)
leucine-rich repeat 568..588 CDD:275380 9/20 (45%)
leucine-rich repeat 589..621 CDD:275380 12/35 (34%)
leucine-rich repeat 622..643 CDD:275380 4/20 (20%)
leucine-rich repeat 699..738 CDD:275380
leucine-rich repeat 739..768 CDD:275380
leucine-rich repeat 794..806 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.