DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and LRRIQ1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_011537119.1 Gene:LRRIQ1 / 84125 HGNCID:25708 Length:1760 Species:Homo sapiens


Alignment Length:162 Identity:43/162 - (26%)
Similarity:65/162 - (40%) Gaps:37/162 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLE---------------AVAETLEELWL-- 100
            :..|.|.:..:.|:.....|::|.|..||:.::..||               :..|.....||  
Human   996 LDCSHNHLTDVEGVENCGLLQILKLQGNYLSELPSLENLVLLRELHLDDNSISTVEAFSSYWLPL 1060

  Fly   101 ------SYNLIEKIKGLTGLKCLKVLYISNNLIKD------WSEFNRLAEIESLEDLVVVGNPLS 153
                  |.|.:.||..|.....|:.|.:|:|.:.|      |.:     ...||.:|.:.|||| 
Human  1061 LQNITISQNSLTKIVPLFHFVSLEKLDVSHNCLSDLKSAIKWFD-----ACYSLHELSLTGNPL- 1119

  Fly   154 EGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
              |.|..||...:|.||.:|.|:|..:..|.|
Human  1120 --LQETNWRDSLLKVLPALRILNGNILNSNSE 1149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 41/155 (26%)
leucine-rich repeat 50..71 CDD:275380 3/17 (18%)
leucine-rich repeat 95..116 CDD:275380 7/28 (25%)
leucine-rich repeat 117..141 CDD:275380 6/29 (21%)
LRRIQ1XP_011537119.1 DUF4515 164..343 CDD:291649
LRR_4 818..856 CDD:289563
leucine-rich repeat 820..841 CDD:275380
leucine-rich repeat 842..862 CDD:275380
leucine-rich repeat 863..884 CDD:275380
leucine-rich repeat 885..920 CDD:275380
leucine-rich repeat 921..970 CDD:275380
LRR_RI <963..1095 CDD:238064 22/98 (22%)
leucine-rich repeat 971..992 CDD:275380
leucine-rich repeat 993..1014 CDD:275380 3/17 (18%)
leucine-rich repeat 1015..1036 CDD:275380 7/20 (35%)
LRR_8 1037..1091 CDD:290566 11/53 (21%)
leucine-rich repeat 1037..1060 CDD:275380 3/22 (14%)
leucine-rich repeat 1083..1108 CDD:275380 6/29 (21%)
leucine-rich repeat 1109..1135 CDD:275380 12/28 (43%)
IQ 1338..1354 CDD:197470
IQ 1394..1415 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.