| Sequence 1: | NP_610483.1 | Gene: | ODA-Dnal1 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001324697.1 | Gene: | AIR9 / 818033 | AraportID: | AT2G34680 | Length: | 1768 | Species: | Arabidopsis thaliana |
| Alignment Length: | 52 | Identity: | 14/52 - (26%) |
|---|---|---|---|
| Similarity: | 20/52 - (38%) | Gaps: | 3/52 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 101 LCNEISSPKHQCVV--CSSLVEANCLANPTALTAVQCPAPSNVDLTAAQCYS 150 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ODA-Dnal1 | NP_610483.1 | PPP1R42 | 37..180 | CDD:455733 | 14/52 (27%) |
| leucine-rich repeat | 50..71 | CDD:275380 | |||
| leucine-rich repeat | 95..116 | CDD:275380 | 4/16 (25%) | ||
| leucine-rich repeat | 117..141 | CDD:275380 | 5/23 (22%) | ||
| AIR9 | NP_001324697.1 | TraV | <170..>236 | CDD:450310 | |
| leucine-rich repeat | 332..353 | CDD:275380 | |||
| PPP1R42 | 333..>497 | CDD:455733 | |||
| leucine-rich repeat | 354..375 | CDD:275380 | |||
| leucine-rich repeat | 376..396 | CDD:275380 | |||
| leucine-rich repeat | 400..421 | CDD:275380 | |||
| leucine-rich repeat | 422..442 | CDD:275380 | |||
| leucine-rich repeat | 443..464 | CDD:275380 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||