DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ODA-Dnal1 and AIR9

DIOPT Version :10

Sequence 1:NP_610483.1 Gene:ODA-Dnal1 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001324697.1 Gene:AIR9 / 818033 AraportID:AT2G34680 Length:1768 Species:Arabidopsis thaliana


Alignment Length:52 Identity:14/52 - (26%)
Similarity:20/52 - (38%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LCNEISSPKHQCVV--CSSLVEANCLANPTALTAVQCPAPSNVDLTAAQCYS 150
            :|.|...||.:..:  |.......||.....:..| ||..:...|..||.:|
plant    90 VCLEEFKPKDELGICPCKHAFHRKCLIKWLEVRKV-CPLCNMPVLQLAQLHS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ODA-Dnal1NP_610483.1 PPP1R42 37..180 CDD:455733 14/52 (27%)
leucine-rich repeat 50..71 CDD:275380
leucine-rich repeat 95..116 CDD:275380 4/16 (25%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
AIR9NP_001324697.1 TraV <170..>236 CDD:450310
leucine-rich repeat 332..353 CDD:275380
PPP1R42 333..>497 CDD:455733
leucine-rich repeat 354..375 CDD:275380
leucine-rich repeat 376..396 CDD:275380
leucine-rich repeat 400..421 CDD:275380
leucine-rich repeat 422..442 CDD:275380
leucine-rich repeat 443..464 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.