DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8800 and Lrrc9

DIOPT Version :9

Sequence 1:	NP_610483.1	Gene:	CG8800 / 35962	FlyBaseID:	FBgn0033408	Length:	188	Species:	Drosophila melanogaster
Sequence 2:	XP_006516438.1	Gene:	Lrrc9 / 78257	MGIID:	1925507	Length:	1457	Species:	Mus musculus

Alignment Length:	163	Identity:	52/163 - (31%)
Similarity:	83/163 - (50%)	Gaps:	32/163 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 STLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIE 106
            |.|.|.:|.:.:.::...||||.||.|.:.|:.|.|..|.|.:|..||.:.: ||.|||::|:|:
Mouse    70 SGLETCLQLKELWIAECCIEKIEGLQGCRNLEKLYLYYNKISKIENLEKLIK-LEVLWLNHNMIK 133

  Fly   107 KIKGLTGLKCLKVLYISNNLIKDWSEFNR-LAEIESLEDLVVVGNPLSE---------------- 154
            .|:||..||.||.|.::.||:   |...| |...|.||.|.:.||.::.
Mouse   134 NIEGLQTLKNLKDLNLAGNLV---SSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDL 195

  Fly   155 GLDEPTWRAE-----C------IKRLPTIRKLD 176
            .|::|.:::.     |      :..||::::||
Mouse   196 CLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8800	NP_610483.1	PPP1R42	37..180	CDD:411060	52/163 (32%)
		leucine-rich repeat	50..71	CDD:275380	7/20 (35%)
		leucine-rich repeat	95..116	CDD:275380	11/20 (55%)
		leucine-rich repeat	117..141	CDD:275380	8/24 (33%)
Lrrc9	XP_006516438.1	internalin_A	<32..>264	CDD:380193	52/163 (32%)
		leucine-rich repeat	47..77	CDD:275380	3/6 (50%)
		leucine-rich repeat	78..99	CDD:275380	7/20 (35%)
		leucine-rich repeat	100..121	CDD:275380	8/20 (40%)
		leucine-rich repeat	122..143	CDD:275380	11/20 (55%)
		leucine-rich repeat	144..166	CDD:275380	8/24 (33%)
		leucine-rich repeat	167..191	CDD:275380	5/23 (22%)
		leucine-rich repeat	192..223	CDD:275380	4/30 (13%)
		internalin_A	685..>959	CDD:380193
		leucine-rich repeat	689..708	CDD:275380
		leucine-rich repeat	709..730	CDD:275380
		leucine-rich repeat	731..752	CDD:275380
		leucine-rich repeat	753..779	CDD:275380
		leucine-rich repeat	780..806	CDD:275380
		leucine-rich repeat	807..865	CDD:275380
		leucine-rich repeat	866..901	CDD:275380
		internalin_A	879..>1262	CDD:380193
		leucine-rich repeat	902..923	CDD:275380
		leucine-rich repeat	924..945	CDD:275380
		leucine-rich repeat	946..969	CDD:275380
		leucine-rich repeat	992..1016	CDD:275380
		leucine-rich repeat	1017..1044	CDD:275380
		leucine-rich repeat	1132..1157	CDD:275380
		leucine-rich repeat	1158..1194	CDD:275380
		leucine-rich repeat	1195..1218	CDD:275380
		leucine-rich repeat	1219..1240	CDD:275380
		LRR_9	<1227..1366	CDD:373143
		leucine-rich repeat	1241..1264	CDD:275380
		leucine-rich repeat	1265..1286	CDD:275380
		leucine-rich repeat	1287..1311	CDD:275380
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810