DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Lrriq1

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_011241894.1 Gene:Lrriq1 / 74978 MGIID:1922228 Length:1717 Species:Mus musculus


Alignment Length:237 Identity:55/237 - (23%)
Similarity:79/237 - (33%) Gaps:111/237 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VQCERIS------MSTNMIEKIFGLSGMKCLKVLSLSRNYIKQISGLEAV--------------- 91
            :.||.:.      ::.|::..|.|..|...|:.|.||.|.|.:|||||::               
Mouse   868 ISCENLENLSVVLLNNNLLTSIHGFDGCTNLQSLELSHNKITRISGLESLKYLQELTVDHNQLIS 932

  Fly    92 ------AET--------------------------------------------LEELWLSYNLIE 106
                  |.|                                            |.||.|..|.|.
Mouse   933 TKGLCEAPTIVYLDCSHNHLTGIDGIGNCGLLQIIKLQGNYLREPPSLRNHVLLRELHLDDNSIS 997

  Fly   107 KIKGLTG------------------------LKCLKVLYISNNLIKD------WSEFNRLAEIES 141
            .::||:.                        |..|:.|.:|||.:.|      |  ||   ...|
Mouse   998 SVEGLSSCWLPLLQYLSISQNSLATIVPLFHLVSLEKLDVSNNCLSDLTNVMCW--FN---ACYS 1057

  Fly   142 LEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLN 183
            |.:|.:.|||:   |.|..||...:|.||.:|.|:|:  :||
Mouse  1058 LRELCLTGNPV---LQEINWRDSILKTLPALRVLNGD--MLN 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 53/232 (23%)
leucine-rich repeat 50..71 CDD:275380 6/26 (23%)
leucine-rich repeat 95..116 CDD:275380 9/44 (20%)
leucine-rich repeat 117..141 CDD:275380 9/29 (31%)
Lrriq1XP_011241894.1 PTZ00121 <173..657 CDD:173412
internalin_A 808..>1056 CDD:380193 37/192 (19%)
leucine-rich repeat 833..854 CDD:275380
leucine-rich repeat 855..875 CDD:275380 2/6 (33%)
leucine-rich repeat 876..897 CDD:275380 4/20 (20%)
leucine-rich repeat 898..919 CDD:275380 11/20 (55%)
leucine-rich repeat 920..941 CDD:275380 1/20 (5%)
leucine-rich repeat 942..963 CDD:275380 0/20 (0%)
leucine-rich repeat 964..982 CDD:275380 0/17 (0%)
leucine-rich repeat 986..1009 CDD:275380 8/22 (36%)
leucine-rich repeat 1010..1031 CDD:275380 1/20 (5%)
leucine-rich repeat 1058..1084 CDD:275380 11/28 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.