DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ODA-Dnal1 and Lrguk

DIOPT Version :10

Sequence 1:NP_610483.1 Gene:ODA-Dnal1 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006506776.1 Gene:Lrguk / 74354 MGIID:1921604 Length:1341 Species:Mus musculus


Alignment Length:165 Identity:50/165 - (30%)
Similarity:88/165 - (53%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NSLTAKVIDLQFQWPPIEKMDSTLGTLVQCERISMSTNMIEKIFGLSGMKCLKVLSLSRNYIKQI 85
            ::||..::|..    .||:: :.|...:....:|::.|.|..|.|| |...:||||||.|.|:.|
Mouse   215 HTLTQLILDNN----EIEEI-TGLENCISLTHLSLAGNKITTIKGL-GTLPIKVLSLSNNMIETI 273

  Fly    86 SGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLIKDWSEFNRLAEIESLEDLVVVGN 150
            :|||.: :.|:.|.||:|.|..::||.....|:|:.:.:|.||:.||...:..:..|..|.::.|
Mouse   274 TGLEEL-KALQNLDLSHNQISSLQGLENHDLLEVINLEDNKIKELSEIEYIENLPILRVLNLLRN 337

  Fly   151 PLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLNEE 185
            |:.   .:|.:....|..|..:.:||.:.:.:.|:
Mouse   338 PIQ---TKPEYWFFVIYMLLRLTELDQQKIKVEEK 369

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ODA-Dnal1NP_610483.1 PPP1R42 37..180 CDD:455733 46/142 (32%)
leucine-rich repeat 50..71 CDD:275380 7/20 (35%)
leucine-rich repeat 95..116 CDD:275380 8/20 (40%)
leucine-rich repeat 117..141 CDD:275380 7/23 (30%)
LrgukXP_006506776.1 LRR 97..>340 CDD:443914 44/131 (34%)
leucine-rich repeat 131..150 CDD:275380
leucine-rich repeat 151..172 CDD:275380
leucine-rich repeat 173..194 CDD:275380