DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8800 and Lrrc56

DIOPT Version :9

Sequence 1:NP_610483.1 Gene:CG8800 / 35962 FlyBaseID:FBgn0033408 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_006536303.1 Gene:Lrrc56 / 70552 MGIID:1917802 Length:559 Species:Mus musculus


Alignment Length:198 Identity:52/198 - (26%)
Similarity:89/198 - (44%) Gaps:27/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRW-EEREQQNSL--TAKVIDLQF---QWPPIEKMDSTLG-------TLVQCERISMSTNMIEKI 63
            :|| |||.....|  .|:|.|||.   ....::...::||       .|:|   :.::.:.:..:
Mouse    54 ERWVEERLSPARLQALAQVDDLQLVRVLEMCVDTRKNSLGNFGLYLPNLIQ---LKLNHSYLGSL 115

  Fly    64 FGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLI 127
            ..| :.:..|:||.|:|..:..:.|:.:..| |:||::|||.|..:..|..|:.|:||.:..|.:
Mouse   116 RDLGTSLGHLQVLWLARCGLTDLDGIGSFLE-LKELYVSYNNISDLSPLCLLEQLEVLDLEGNNV 179

  Fly   128 KDWSEFNRLAEIESLEDLVVVGN---------PLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLN 183
            :|..:...|.....|..|.:.||         |.::......:|||..|.:|.:..||..|....
Mouse   180 EDLGQMRYLQLCPRLAMLTLEGNLVCLKPDPGPSNKAPQGYNYRAEVKKLIPQLHVLDEVPTTCT 244

  Fly   184 EEP 186
            ..|
Mouse   245 SAP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8800NP_610483.1 PPP1R42 37..180 CDD:411060 39/159 (25%)
leucine-rich repeat 50..71 CDD:275380 1/21 (5%)
leucine-rich repeat 95..116 CDD:275380 9/20 (45%)
leucine-rich repeat 117..141 CDD:275380 6/23 (26%)
Lrrc56XP_006536303.1 internalin_A <99..>202 CDD:380193 27/106 (25%)
leucine-rich repeat 102..124 CDD:275380 3/24 (13%)
leucine-rich repeat 125..146 CDD:275380 6/20 (30%)
leucine-rich repeat 147..168 CDD:275380 9/20 (45%)
leucine-rich repeat 169..193 CDD:275380 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.