Sequence 1: | NP_610483.1 | Gene: | CG8800 / 35962 | FlyBaseID: | FBgn0033408 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006536303.1 | Gene: | Lrrc56 / 70552 | MGIID: | 1917802 | Length: | 559 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 89/198 - (44%) | Gaps: | 27/198 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 KRW-EEREQQNSL--TAKVIDLQF---QWPPIEKMDSTLG-------TLVQCERISMSTNMIEKI 63
Fly 64 FGL-SGMKCLKVLSLSRNYIKQISGLEAVAETLEELWLSYNLIEKIKGLTGLKCLKVLYISNNLI 127
Fly 128 KDWSEFNRLAEIESLEDLVVVGN---------PLSEGLDEPTWRAECIKRLPTIRKLDGEPVVLN 183
Fly 184 EEP 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8800 | NP_610483.1 | PPP1R42 | 37..180 | CDD:411060 | 39/159 (25%) |
leucine-rich repeat | 50..71 | CDD:275380 | 1/21 (5%) | ||
leucine-rich repeat | 95..116 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 117..141 | CDD:275380 | 6/23 (26%) | ||
Lrrc56 | XP_006536303.1 | internalin_A | <99..>202 | CDD:380193 | 27/106 (25%) |
leucine-rich repeat | 102..124 | CDD:275380 | 3/24 (13%) | ||
leucine-rich repeat | 125..146 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 147..168 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 169..193 | CDD:275380 | 6/23 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |